DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and trappc6b

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001006029.1 Gene:trappc6b / 450008 ZFINID:ZDB-GENE-041010-122 Length:157 Species:Danio rerio


Alignment Length:156 Identity:86/156 - (55%)
Similarity:113/156 - (72%) Gaps:5/156 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEEILFDCLHAEIVNYCL-----DSNKEHDLATLEYIGFTTGYRLIERLTREVSRFKDELETMK 60
            |::|.||..||:||:.|..     :|.....::.||.:||..|..||||.|::..||||||:.||
Zfish     1 MADEALFQFLHSEIIQYVNSAETGESENGRCVSKLENMGFRVGQGLIERFTQDTPRFKDELDVMK 65

  Fly    61 FICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGALS 125
            |||.|||..::|||:||||||:.|:||:||..||.||::|.|.:.|||||||:||||||||||||
Zfish    66 FICKDFWTSVFKKQIDNLRTNHQGIYVLQDNKFRLLTQLSAGKQYLEHAPKFLAFTCGLVRGALS 130

  Fly   126 NLGINSTVTAEVQSIPACKFHIEVNR 151
            |:|:.|.|||||..:|||||.:.:.:
Zfish   131 NIGVKSIVTAEVSVMPACKFQVMIQK 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 85/150 (57%)
trappc6bNP_001006029.1 TRAPPC6A_Trs33 3..155 CDD:271347 85/151 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581844
Domainoid 1 1.000 175 1.000 Domainoid score I3595
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42466
Inparanoid 1 1.050 181 1.000 Inparanoid score I3973
OMA 1 1.010 - - QHG59616
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - otm24318
orthoMCL 1 0.900 - - OOG6_102793
Panther 1 1.100 - - O PTHR12817
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2318
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.