DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and trappc6a

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001001218.1 Gene:trappc6a / 407891 XenbaseID:XB-GENE-971163 Length:158 Species:Xenopus tropicalis


Alignment Length:157 Identity:79/157 - (50%)
Similarity:113/157 - (71%) Gaps:6/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEEILFDCLHAEIVNYCL----DSNKEHDLAT--LEYIGFTTGYRLIERLTREVSRFKDELETM 59
            |::|.||:.||.|:|::..    :..::|...|  ||.:||..|..||||||::...|||:||.:
 Frog     1 MADETLFELLHMEMVSHVYEHVEEDEEDHGKHTRVLEGMGFRVGQGLIERLTKDSPSFKDDLEVV 65

  Fly    60 KFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGAL 124
            ||:|.|||.:::|||:||||||:.|.||:||..|..||::|...:.||.||||:.:||||::|||
 Frog    66 KFVCKDFWTILFKKQIDNLRTNHQGTYVLQDNRFMLLTQLSSSKQYLEEAPKFLPYTCGLIKGAL 130

  Fly   125 SNLGINSTVTAEVQSIPACKFHIEVNR 151
            |||||:.||:|||..:|||||.:.::|
 Frog   131 SNLGISCTVSAEVVVMPACKFQVVISR 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 77/151 (51%)
trappc6aNP_001001218.1 TRAPPC6A_Trs33 3..156 CDD:271347 77/152 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 164 1.000 Domainoid score I3891
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 170 1.000 Inparanoid score I4004
OMA 1 1.010 - - QHG59616
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - otm48469
Panther 1 1.100 - - LDO PTHR12817
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2318
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.110

Return to query results.
Submit another query.