DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and trappc6bl

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_956955.1 Gene:trappc6bl / 393634 ZFINID:ZDB-GENE-040426-1602 Length:161 Species:Danio rerio


Alignment Length:160 Identity:79/160 - (49%)
Similarity:110/160 - (68%) Gaps:9/160 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEEILFDCLHAEIVNYC---------LDSNKEHDLATLEYIGFTTGYRLIERLTREVSRFKDEL 56
            |:::.||:.||.|||.:.         :|..:...::|||.:||..|..||||.|::...|||:|
Zfish     1 MADDALFEFLHMEIVAHVYKEQATRDDIDKERVTCVSTLELMGFRVGQGLIERFTKDCPTFKDDL 65

  Fly    57 ETMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVR 121
            :.|||:|.|||..|:|||:||||||:.|.||:||..|..||:.|.|.:.||.|||::||:||::|
Zfish    66 DIMKFVCKDFWSTIFKKQIDNLRTNHQGTYVLQDNKFALLTQFSSGKQYLEEAPKYLAFSCGMIR 130

  Fly   122 GALSNLGINSTVTAEVQSIPACKFHIEVNR 151
            |||||||:.|.|||||..:|:|||.:.|.:
Zfish   131 GALSNLGLESVVTAEVSLMPSCKFQVVVQK 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 77/154 (50%)
trappc6blNP_956955.1 TRAPPC6A_Trs33 3..159 CDD:271347 77/155 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581845
Domainoid 1 1.000 175 1.000 Domainoid score I3595
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 181 1.000 Inparanoid score I3973
OMA 1 1.010 - - QHG59616
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - otm24318
orthoMCL 1 0.900 - - OOG6_102793
Panther 1 1.100 - - LDO PTHR12817
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2318
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.