DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and Trappc6b

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_001100203.1 Gene:Trappc6b / 299075 RGDID:1309325 Length:158 Species:Rattus norvegicus


Alignment Length:157 Identity:83/157 - (52%)
Similarity:112/157 - (71%) Gaps:6/157 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSEEILFDCLHAEIVNYCLDSNKEHD------LATLEYIGFTTGYRLIERLTREVSRFKDELETM 59
            |::|.||..||.|:|:....|.::.:      :..||.:||..|..||||.|::.:||||||:.|
  Rat     1 MADEALFLLLHNEMVSGVYKSAEQGEVENGRCITKLENMGFRVGQGLIERFTKDTARFKDELDIM 65

  Fly    60 KFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISPGTKQLEHAPKFVAFTCGLVRGAL 124
            ||||.|||..::|||:||||||:.|:||:||..||.|.::|.|.:.||||.|::||||||:||.|
  Rat    66 KFICKDFWTTVFKKQIDNLRTNHQGIYVLQDNKFRLLIQLSAGKQYLEHASKYLAFTCGLIRGGL 130

  Fly   125 SNLGINSTVTAEVQSIPACKFHIEVNR 151
            |||||.|.|||||.|:|||||.:.:.:
  Rat   131 SNLGIKSIVTAEVSSMPACKFQVMIQK 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 82/151 (54%)
Trappc6bNP_001100203.1 TRAPPC6A_Trs33 3..156 CDD:271347 82/152 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166341816
Domainoid 1 1.000 165 1.000 Domainoid score I3839
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42466
Inparanoid 1 1.050 172 1.000 Inparanoid score I4013
OMA 1 1.010 - - QHG59616
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - otm45390
orthoMCL 1 0.900 - - OOG6_102793
Panther 1 1.100 - - O PTHR12817
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.