DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and trs33

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_592831.2 Gene:trs33 / 2542905 PomBaseID:SPAC13G6.05c Length:253 Species:Schizosaccharomyces pombe


Alignment Length:131 Identity:41/131 - (31%)
Similarity:75/131 - (57%) Gaps:2/131 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 EHDLATLEYIGFTTGYRLIERLTREVSRFKDELETMKFICTDFWMLIYKKQVDNLRTNNHGMYVV 88
            |.|...||.|||..|.::.|||....:|..:..:.|:|:|.:.|.::::|.:|||:||..|::|:
pombe    45 ESDFQMLESIGFQVGRKITERLLLNRNRITETTDVMRFLCRELWPIVFRKPLDNLKTNRRGIFVL 109

  Fly    89 QDKAFRFLTRIS--PGTKQLEHAPKFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEVNR 151
            .|..|.:.|:::  .||:..:....:..|..|.:||.:...|.::.|.|:..::|.|.||::.:.
pombe   110 TDTYFYWFTKMTAMTGTEMAQITTPYFYFPSGFIRGVVYTFGYSAQVIAQCPNLPTCIFHVKFSP 174

  Fly   152 N 152
            |
pombe   175 N 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 40/127 (31%)
trs33NP_592831.2 TRAPPC6A_Trs33 12..173 CDD:271347 40/127 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 91 1.000 Domainoid score I2051
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42466
Inparanoid 1 1.050 93 1.000 Inparanoid score I1724
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - oto101192
orthoMCL 1 0.900 - - OOG6_102793
Panther 1 1.100 - - LDO PTHR12817
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2318
SonicParanoid 1 1.000 - - X1632
TreeFam 1 0.960 - -
1312.850

Return to query results.
Submit another query.