DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Trs33 and trpp-6

DIOPT Version :9

Sequence 1:NP_650450.1 Gene:Trs33 / 41866 FlyBaseID:FBgn0266722 Length:152 Species:Drosophila melanogaster
Sequence 2:NP_505571.1 Gene:trpp-6 / 179394 WormBaseID:WBGene00010699 Length:185 Species:Caenorhabditis elegans


Alignment Length:178 Identity:68/178 - (38%)
Similarity:97/178 - (54%) Gaps:35/178 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 FDCLHAEIVNYCLDSNKEH------------------DL-----------------ATLEYIGFT 36
            ||.||.||:...|:|.|:.                  |:                 ..||.|||.
 Worm     5 FDILHLEIIRSTLESEKDRCEAKEKFGTIIDNLNGPADIEKYESLVQKAFLHANAETKLESIGFR 69

  Fly    37 TGYRLIERLTREVSRFKDELETMKFICTDFWMLIYKKQVDNLRTNNHGMYVVQDKAFRFLTRISP 101
            .|.:|:|::::|..:...|||.:||||.|||..::.|||||||||:.|:|||||..|..|.....
 Worm    70 VGRQLVEKVSKESPKLVTELEIVKFICKDFWSSVFGKQVDNLRTNHQGVYVVQDGRFTTLRSFPE 134

  Fly   102 GTKQLEHAPKFVAFTCGLVRGALSNLGINSTVTAEVQSIPACKFHIEV 149
            |.:.::.:..|:||.|||:||||:.|.|.:.||..::|:|:.||||:|
 Worm   135 GDQYVKESGYFLAFPCGLLRGALAGLNIRAIVTPTIESVPSVKFHIQV 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Trs33NP_650450.1 TRAPPC6A_Trs33 4..150 CDD:271347 68/178 (38%)
trpp-6NP_505571.1 TRAPPC6A_Trs33 2..183 CDD:271347 68/178 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159900
Domainoid 1 1.000 124 1.000 Domainoid score I3425
eggNOG 1 0.900 - - E1_KOG3316
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H42466
Inparanoid 1 1.050 124 1.000 Inparanoid score I3289
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG59616
OrthoDB 1 1.010 - - D1566836at2759
OrthoFinder 1 1.000 - - FOG0002452
OrthoInspector 1 1.000 - - oto19188
orthoMCL 1 0.900 - - OOG6_102793
Panther 1 1.100 - - LDO PTHR12817
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2318
SonicParanoid 1 1.000 - - X1632
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.800

Return to query results.
Submit another query.