DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31301 and NIH

DIOPT Version :10

Sequence 1:NP_650449.1 Gene:CG31301 / 41865 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_172152.1 Gene:NIH / 837177 AraportID:AT1G06670 Length:1576 Species:Arabidopsis thaliana


Alignment Length:55 Identity:22/55 - (40%)
Similarity:32/55 - (58%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 RLIENYVRSDDIRDMQFEPTFSKEERTTLHQIARQFGLRSASYGSGESRRLLITK 390
            :::|:: |:.......||...:..||..:||:.|..||||.|.||||.|||.:.|
plant    23 KVLEDF-RASGNDSYVFEQQLTNSERGIIHQMCRTMGLRSKSNGSGEERRLSLFK 76

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:463409
G_patch 280..323 CDD:197727
R3H_NRF 331..390 CDD:100069 21/53 (40%)
NIHNP_172152.1 R3H_DEXH_helicase 18..76 CDD:100077 21/53 (40%)
HrpA 217..>820 CDD:441249
ANKYR <468..575 CDD:440430
ANK repeat 475..505 CDD:293786
ANK repeat 507..533 CDD:293786
OB_NTP_bind 919..1007 CDD:400182
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.