DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31301 and HVT1

DIOPT Version :10

Sequence 1:NP_650449.1 Gene:CG31301 / 41865 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_850154.2 Gene:HVT1 / 817631 AraportID:AT2G30800 Length:1299 Species:Arabidopsis thaliana


Alignment Length:55 Identity:22/55 - (40%)
Similarity:32/55 - (58%) Gaps:1/55 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   336 RLIENYVRSDDIRDMQFEPTFSKEERTTLHQIARQFGLRSASYGSGESRRLLITK 390
            ::||:: |:.......||...|..||..:||:.|:.|::|.|.|.||.|||.|.|
plant    27 KVIEDF-RASGNEVYTFEHNLSNNERGVIHQMCRKMGIQSKSSGRGEQRRLSIFK 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:463409
G_patch 280..323 CDD:197727
R3H_NRF 331..390 CDD:100069 21/53 (40%)
HVT1NP_850154.2 R3H_DEXH_helicase 22..80 CDD:100077 21/53 (40%)
HrpA 187..>789 CDD:441249
ANK repeat 417..444 CDD:293786
ANK repeat 446..481 CDD:293786
ANKYR <453..541 CDD:440430
ANK repeat 483..507 CDD:293786
OB_NTP_bind 895..983 CDD:400182
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.