DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31301 and cdkn2aipnl

DIOPT Version :9

Sequence 1:NP_650449.1 Gene:CG31301 / 41865 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:XP_012814455.1 Gene:cdkn2aipnl / 549001 XenbaseID:XB-GENE-1003699 Length:94 Species:Xenopus tropicalis


Alignment Length:72 Identity:21/72 - (29%)
Similarity:39/72 - (54%) Gaps:4/72 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VDSYKTEYESDEHWDLRRSFMLAHKDRFEE----DRLVCLAQTFVNMEFMGCKYPSATMLLVAEL 94
            |..:::..|||:.|..|..|::.:...||:    |||:.|:..:.|..||||:|.:..:..|..:
 Frog     6 VGQFQSFSESDKQWQAREEFIIRNLKHFEDESALDRLLALSMVWANHVFMGCRYSNELLEKVFSM 70

  Fly    95 SKEIAAD 101
            ::.|..:
 Frog    71 AEGIVVE 77

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 21/72 (29%)
G_patch 280..323 CDD:197727
R3H_NRF 331..390 CDD:100069
cdkn2aipnlXP_012814455.1 XTBD 6..91 CDD:371816 21/72 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I12113
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.