DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31301 and Cdkn2aipnl

DIOPT Version :10

Sequence 1:NP_650449.1 Gene:CG31301 / 41865 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_084252.1 Gene:Cdkn2aipnl / 52626 MGIID:1261797 Length:116 Species:Mus musculus


Alignment Length:75 Identity:18/75 - (24%)
Similarity:36/75 - (48%) Gaps:8/75 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DSYKTEYESDEHWDLRRSFMLAHKDRFEE--------DRLVCLAQTFVNMEFMGCKYPSATMLLV 91
            :.:::..||::.|..|..|:|.|...:.:        |:|:.|:..:.|..|:||.|....:..|
Mouse    25 EQFRSYSESEKQWKARMEFILRHLPDYRDPPDGGGRLDQLLSLSMVWANHLFLGCSYNKDLLDKV 89

  Fly    92 AELSKEIAAD 101
            .|::..|..:
Mouse    90 MEMADGIEVE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:463409 18/75 (24%)
G_patch 280..323 CDD:197727
R3H_NRF 331..390 CDD:100069
Cdkn2aipnlNP_084252.1 XTBD 25..113 CDD:463409 18/75 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.