DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31301 and cdkn2aip

DIOPT Version :9

Sequence 1:NP_650449.1 Gene:CG31301 / 41865 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001006085.1 Gene:cdkn2aip / 450065 ZFINID:ZDB-GENE-041010-188 Length:312 Species:Danio rerio


Alignment Length:308 Identity:74/308 - (24%)
Similarity:126/308 - (40%) Gaps:86/308 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LDWDVDSYKTEYESDEHWDLRRSFMLAHKDRFEE----------DRLVCLAQTFVNMEFMGCKYP 84
            :.| |:|.:...|:::.|..||.|:|.:.:.|..          |||:.|:..:.|..|:||:||
Zfish    21 VSW-VESLRGHCETNKQWYARREFVLRNMEAFPTIQPGSPSSSLDRLLSLSMVWANHVFLGCRYP 84

  Fly    85 SATMLLVAELSKEIA---ADFRQKREQ---RLKRTFVSASDAAEQRAKGRRAPPLPSTSSPEDSS 143
            ...|..:.|:::.|.   |..|:.|::   :|||..|||:||..|   |::..|    :.|:|.:
Zfish    85 QRVMDKINEMAEGITVIEAPERKTRDEIMGKLKRPAVSAADADYQ---GKKNKP----NEPDDRA 142

  Fly   144 HIK---------RQCF-GGGDPVDLYQDLRFGRLI------VYLAGG-----------RACLQN- 180
            |.|         .:|. ..|.|.: :|.. |.||.      :..|||           |:|::: 
Zfish   143 HSKCVVHPATSSHKCGPSPGAPAE-HQPF-FNRLYKAVAWKLVSAGGFGPNLEHFEILRSCVESC 205

  Fly   181 ----SCNIANVKYEERVSRDQPLSD-----------NTKYAELLVNDEVIATGQGESLKAAKKAA 230
                :|...            ||.|           ..:..||......:.||.|....||:..|
Zfish   206 KASLTCVFV------------PLKDIPDLPAGRTQREGQVCELRCCTVYMGTGYGRDESAARAMA 258

  Fly   231 YKQAHLTIQSYCYSIKLNATRDTIKVEKNKDGVNIKVTNESADSPCDP 278
            .|:|....|....::|::..|     .:.:|..::.:.:|.:.|...|
Zfish   259 SKEALKVFQGQKVTVKISRRR-----FRGRDVDDLVLLDEQSRSQAFP 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 30/99 (30%)
G_patch 280..323 CDD:197727
R3H_NRF 331..390 CDD:100069
cdkn2aipNP_001006085.1 XTBD 24..115 CDD:288780 25/90 (28%)
XTBD 186..276 CDD:288780 20/101 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592761
Domainoid 1 1.000 60 1.000 Domainoid score I10554
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.