DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG31301 and Cdkn2aipnl

DIOPT Version :9

Sequence 1:NP_650449.1 Gene:CG31301 / 41865 FlyBaseID:FBgn0051301 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001008279.1 Gene:Cdkn2aipnl / 287278 RGDID:1308696 Length:116 Species:Rattus norvegicus


Alignment Length:89 Identity:22/89 - (24%)
Similarity:42/89 - (47%) Gaps:11/89 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 DSYKTEYESDEHWDLRRSFMLAHKDRFEE--------DRLVCLAQTFVNMEFMGCKYPSATMLLV 91
            :.:::..||::.|..|..|:|.|...:.:        |:|:.|:..:.|..|:||.|....:..|
  Rat    25 EQFRSYSESEKQWKARMEFILRHLPDYRDPPDGGGRLDQLLSLSMVWANHLFLGCSYNKDLLDKV 89

  Fly    92 AELSKEI-AADFRQ--KREQRLKR 112
            .|::..| ..|..|  .|.:.:|:
  Rat    90 MEMADGIEVEDLPQFTSRSELMKK 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG31301NP_650449.1 XTBD 34..118 CDD:288780 22/89 (25%)
G_patch 280..323 CDD:197727
R3H_NRF 331..390 CDD:100069
Cdkn2aipnlNP_001008279.1 XTBD 25..113 CDD:403236 21/87 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351031
Domainoid 1 1.000 41 1.000 Domainoid score I12172
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.