powered by:
Protein Alignment Surf4 and AT1G48510
DIOPT Version :9
Sequence 1: | NP_477222.1 |
Gene: | Surf4 / 41864 |
FlyBaseID: | FBgn0019925 |
Length: | 270 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001321913.1 |
Gene: | AT1G48510 / 841272 |
AraportID: | AT1G48510 |
Length: | 387 |
Species: | Arabidopsis thaliana |
Alignment Length: | 63 |
Identity: | 14/63 - (22%) |
Similarity: | 24/63 - (38%) |
Gaps: | 21/63 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 109 YSILWDF----------QFLLRNFA----------LIGALLLVLAEARIEG-RSLFAGVPSMG 150
|::||.: ..|:|... ||...:||....:|.. |:||..:.::|
plant 312 YTVLWHWSSLTCFIKASSILMRRLTKSDPIGVEPILIPISILVFICTKIYSLRNLFCKIDTIG 374
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Surf4 | NP_477222.1 |
SURF4 |
5..270 |
CDD:111019 |
14/63 (22%) |
AT1G48510 | NP_001321913.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23427 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.