DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf4 and AT1G48510

DIOPT Version :9

Sequence 1:NP_477222.1 Gene:Surf4 / 41864 FlyBaseID:FBgn0019925 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001321913.1 Gene:AT1G48510 / 841272 AraportID:AT1G48510 Length:387 Species:Arabidopsis thaliana


Alignment Length:63 Identity:14/63 - (22%)
Similarity:24/63 - (38%) Gaps:21/63 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 YSILWDF----------QFLLRNFA----------LIGALLLVLAEARIEG-RSLFAGVPSMG 150
            |::||.:          ..|:|...          ||...:||....:|.. |:||..:.::|
plant   312 YTVLWHWSSLTCFIKASSILMRRLTKSDPIGVEPILIPISILVFICTKIYSLRNLFCKIDTIG 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf4NP_477222.1 SURF4 5..270 CDD:111019 14/63 (22%)
AT1G48510NP_001321913.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23427
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.