DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf4 and SURF4

DIOPT Version :9

Sequence 1:NP_477222.1 Gene:Surf4 / 41864 FlyBaseID:FBgn0019925 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_149351.1 Gene:SURF4 / 6836 HGNCID:11476 Length:269 Species:Homo sapiens


Alignment Length:266 Identity:159/266 - (59%)
Similarity:210/266 - (78%) Gaps:0/266 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NEYIAKTEDVAEQVIKRGKNVLPTVARLCLIATFFEDGLRMYIQWNEQREYMDMSWGCGKFLATV 69
            |:.:...||.|:|.::..|..||.|||||||:||.|||:||:.||:|||:|:|.:|.||..||:.
Human     4 NDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQRDYIDTTWNCGYLLASS 68

  Fly    70 FVLVNLLGQLGGCGMVMARFKVDIAVGLLFFIVVLQTVAYSILWDFQFLLRNFALIGALLLVLAE 134
            ||.:||||||.||.:|::|..|..|...||.|:.|||:|||||||.:||:||.||.|.|||:|||
Human    69 FVFLNLLGQLTGCVLVLSRNFVQYACFGLFGIIALQTIAYSILWDLKFLMRNLALGGGLLLLLAE 133

  Fly   135 ARIEGRSLFAGVPSMGENKPKNFMQLAGRILLAFMFITLIRFELSVWQVIQDIIGSILMVLVVLG 199
            :|.||:|:|||||:|.|:.||.:|||.||:||..||:||:.|:.|.:.::|:|:|:.||:||.:|
Human   134 SRSEGKSMFAGVPTMRESSPKQYMQLGGRVLLVLMFMTLLHFDASFFSIVQNIVGTALMILVAIG 198

  Fly   200 YKTKLSALILVALLTILNLYHNAWWTIPSYKPLRDFLKYDFFQTLSVIGGLLMIVSLGPGGVSMD 264
            :||||:||.||..|..:|:|.||:||||.|||:.||||||||||:|||||||::|:|||||||||
Human   199 FKTKLAALTLVVWLFAINVYFNAFWTIPVYKPMHDFLKYDFFQTMSVIGGLLLVVALGPGGVSMD 263

  Fly   265 EHKKKW 270
            |.||:|
Human   264 EKKKEW 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf4NP_477222.1 SURF4 5..270 CDD:111019 158/264 (60%)
SURF4NP_149351.1 SURF4 4..269 CDD:111019 158/264 (60%)
Di-lysine motif. /evidence=ECO:0000269|PubMed:18287528 266..269 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143681
Domainoid 1 1.000 337 1.000 Domainoid score I1118
eggNOG 1 0.900 - - E1_COG2259
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6052
Inparanoid 1 1.050 337 1.000 Inparanoid score I2397
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51950
OrthoDB 1 1.010 - - D1272733at2759
OrthoFinder 1 1.000 - - FOG0003735
OrthoInspector 1 1.000 - - oto89579
orthoMCL 1 0.900 - - OOG6_104535
Panther 1 1.100 - - LDO PTHR23427
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1415
SonicParanoid 1 1.000 - - X2591
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.