DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf4 and surf4

DIOPT Version :9

Sequence 1:NP_477222.1 Gene:Surf4 / 41864 FlyBaseID:FBgn0019925 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_957421.1 Gene:surf4 / 394102 ZFINID:ZDB-GENE-040426-1426 Length:269 Species:Danio rerio


Alignment Length:265 Identity:156/265 - (58%)
Similarity:214/265 - (80%) Gaps:0/265 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EYIAKTEDVAEQVIKRGKNVLPTVARLCLIATFFEDGLRMYIQWNEQREYMDMSWGCGKFLATVF 70
            :.::..||:|:|.::..|..||.:||||||:||.|||:||:.||:|||:|::.:|.||.||||.|
Zfish     5 DMMSAAEDLADQFLRVTKQYLPHMARLCLISTFLEDGIRMWFQWSEQRDYIEATWSCGYFLATCF 69

  Fly    71 VLVNLLGQLGGCGMVMARFKVDIAVGLLFFIVVLQTVAYSILWDFQFLLRNFALIGALLLVLAEA 135
            |::||:||:|||.:|::|..|..|...||.|:.|||||||||||.:||:||.||.|.|||:|||:
Zfish    70 VIINLIGQIGGCVLVLSRNLVQYACFGLFCIIALQTVAYSILWDLKFLMRNLALGGGLLLLLAES 134

  Fly   136 RIEGRSLFAGVPSMGENKPKNFMQLAGRILLAFMFITLIRFELSVWQVIQDIIGSILMVLVVLGY 200
            |.||:|:|||||||||:.||.:|||.||:||..||:||:.|:...:.::|:::|:.|::||.:|:
Zfish   135 RSEGKSMFAGVPSMGESSPKQYMQLGGRVLLVLMFMTLLHFDSDFFSILQNMVGTALIILVAVGF 199

  Fly   201 KTKLSALILVALLTILNLYHNAWWTIPSYKPLRDFLKYDFFQTLSVIGGLLMIVSLGPGGVSMDE 265
            ||||:||.||..|..:|:|.||:||:|:|||:.||||||||||.|||||||::|:||||||||||
Zfish   200 KTKLAALTLVVWLLAINVYFNAFWTVPAYKPMHDFLKYDFFQTTSVIGGLLLVVALGPGGVSMDE 264

  Fly   266 HKKKW 270
            .||:|
Zfish   265 KKKEW 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf4NP_477222.1 SURF4 5..270 CDD:111019 155/263 (59%)
surf4NP_957421.1 SURF4 4..269 CDD:111019 155/263 (59%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:O15260 266..269 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576591
Domainoid 1 1.000 345 1.000 Domainoid score I1025
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H6052
Inparanoid 1 1.050 347 1.000 Inparanoid score I2276
OMA 1 1.010 - - QHG51950
OrthoDB 1 1.010 - - D1272733at2759
OrthoFinder 1 1.000 - - FOG0003735
OrthoInspector 1 1.000 - - otm25541
orthoMCL 1 0.900 - - OOG6_104535
Panther 1 1.100 - - LDO PTHR23427
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1415
SonicParanoid 1 1.000 - - X2591
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.