DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf4 and CG14070

DIOPT Version :9

Sequence 1:NP_477222.1 Gene:Surf4 / 41864 FlyBaseID:FBgn0019925 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_001285818.1 Gene:CG14070 / 34508 FlyBaseID:FBgn0032313 Length:251 Species:Drosophila melanogaster


Alignment Length:255 Identity:65/255 - (25%)
Similarity:111/255 - (43%) Gaps:58/255 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 EYMDMSWGCGKFLATVFVLVN--LLGQ-------LGGC-GMVMARFKVDIAVGLLFFIV------ 102
            :|..||:   .|:..::.:||  |:|:       :..| |.....|.|.:.:|.:|.|:      
  Fly     2 QYFVMSY---YFMEVLYSVVNTPLVGRERAIVMDVNECFGHFYTCFDVLLTIGAIFLILGTRKEA 63

  Fly   103 ----------VLQTVAYSILWD--FQFLLRNFALIGALLLVLAEARIEGRSLFAGVPSMGENKPK 155
                      |:..:.:|| |.  |.||..:...:|:|||::| |:|..|.......|     ..
  Fly    64 SGVTLLLIGRVIHRLFFSI-WTMFFYFLFNDSLDVGSLLLLMA-AKINLRDQMDWFQS-----KY 121

  Fly   156 NFMQLAGRILLAFMFITLIRFELSVW-----QVIQDIIGSILMVLVVLGYKTKLSALILVALLTI 215
            :.:.|.||:.|:.::|        :|     :.:..|:...|:|.:.||:..||.|.:.|..|..
  Fly   122 HILLLGGRLCLSSLYI--------IWIDEGLETLFSIVSFGLLVFIWLGFHCKLFAYLTVIALLY 178

  Fly   216 LNLYHNAWWTIPSYKPLRDFLKYDFFQTL-SVIGGLLMIVSLGPGGVSMDEHKK----KW 270
            .:::.|.|..:..:..  ..|...:|..| ..|||.||:..||.|..|:|.::|    ||
  Fly   179 HDVFSNHWSMLWGWND--TLLSIQYFSLLFCKIGGFLMLSELGGGRWSVDGYRKRSGEKW 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf4NP_477222.1 SURF4 5..270 CDD:111019 63/253 (25%)
CG14070NP_001285818.1 DoxX <46..231 CDD:304411 51/201 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2259
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.