DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Surf4 and CG17207

DIOPT Version :9

Sequence 1:NP_477222.1 Gene:Surf4 / 41864 FlyBaseID:FBgn0019925 Length:270 Species:Drosophila melanogaster
Sequence 2:NP_996202.1 Gene:CG17207 / 2768665 FlyBaseID:FBgn0038051 Length:220 Species:Drosophila melanogaster


Alignment Length:244 Identity:49/244 - (20%)
Similarity:101/244 - (41%) Gaps:56/244 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 KNVLPTVARLCLIATFFEDGLRMYIQWNEQREYMDMSWGCGKFLATVFVLVNLLGQLGGCGMVMA 87
            |.:|.|:||:.::::|..|.:.:...|..::..::::.|||:..|.|.:.:..:||..|..:::.
  Fly    18 KMLLSTLARMLIVSSFLADAMHICQNWRLEQSILNINCGCGRIAAGVCINLMAIGQFVGSVLIVT 82

  Fly    88 RFKVDIAVGLL----FFIVVLQTVAYSILWDFQFLLRNFALIGALLLVLAEARIEGRSLFAGVPS 148
            ..::....|||    :..:.|.....::...||..    .:|.||::::..:|            
  Fly    83 GKRIYAGTGLLWLAGYLRIALNPTQRNLAKYFQVC----NVISALMVIMLRSR------------ 131

  Fly   149 MGENKPKNFMQLAGRILLAFMFITLIRF---ELSVWQVIQDIIGSILMVLVVLGYKTKLSALILV 210
                         ...::||:.:|.:.:   |..:|.|..: .|..|     ||::.|       
  Fly   132 -------------RTAVVAFLLLTFVNWKDMERHLWLVFYN-FGEQL-----LGHQKK------- 170

  Fly   211 ALLTILNLYHNAWWTI--PSYKPLRDFLKYDFFQTLSVIGGLLMIVSLG 257
            ..:.::.|.|.....:  ||...     :..|:..:||.||.:.||..|
  Fly   171 DPVGLMGLQHVGMQILDDPSLAS-----RESFWHKVSVAGGFIFIVVNG 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Surf4NP_477222.1 SURF4 5..270 CDD:111019 49/244 (20%)
CG17207NP_996202.1 DoxX 15..>93 CDD:304411 17/74 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2259
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23427
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.