DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SerRS-m and SerRS

DIOPT Version :9

Sequence 1:NP_001262599.1 Gene:SerRS-m / 41862 FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_001259982.1 Gene:SerRS / 33518 FlyBaseID:FBgn0031497 Length:501 Species:Drosophila melanogaster


Alignment Length:424 Identity:112/424 - (26%)
Similarity:200/424 - (47%) Gaps:60/424 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 LRRQRSHDAKAVEAPIHRPVPTSAQLDELERNVVVRHHKNNVPLIRSLIQELDAGDQHKLRQL-- 78
            |.:.::..:|.:...:.:..|..|..::|..:|.    |:...::...:|.|......:||.|  
  Fly    53 LNKVKNVCSKVIGEKMKKKEPVGAMSEDLPADVT----KDLTEIVAETLQPLTVNQIKQLRVLID 113

  Fly    79 ------QAELEQLPNATHPRLRDYGEEPRELAQYVHRQLTPQSRLKEFSELARALNLYRMDHLGN 137
                  |..||......:..||:.|       .::|..: |.|..::.:.:.|...  ..:..|.
  Fly   114 DAMTENQKSLELAEQTRNTSLREVG-------NHLHESV-PVSNDEDENRVERTFG--DCEKRGK 168

  Fly   138 Y--------------------TGHKSYYLTGQLATLEQAIIQYALQAVTEHGFKLISVPDILPKE 182
            |                    :|.:.|:|||....||||:||:||..:....:..:..|..:.||
  Fly   169 YSHVDLIVMIDGMNAEKGAVVSGGRGYFLTGAAVFLEQALIQHALHLLYARDYVPLYTPFFMRKE 233

  Fly   183 VIESCGMRTEGERTQVYKL---------DTG---ECLSGTSEMALAGFFANKLLSEDQLPLKVTA 235
            |::.....::.:. ::||:         :.|   :.|..|||..:|.:..::.|.|..||:|...
  Fly   234 VMQEVAQLSQFDE-ELYKVVGKGSEKAEEVGIDEKYLIATSEQPIAAYHRDEWLPESSLPIKYAG 297

  Fly   236 VSRCYRAET-SGLQEEKGIYRVHQFNKVEMFAICT--EEQSEAELEEFKNIEVDLFRRLGLNFRL 297
            :|.|:|.|. |..::.:||:|||||.|||.|.:.:  :.:|...::|.........:.||:.:|:
  Fly   298 LSTCFRQEVGSHGRDTRGIFRVHQFEKVEQFVLTSPHDNKSWEMMDEMIGNAEQFCQSLGIPYRV 362

  Fly   298 LDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQARRLGIRY--RRSADGQILHAHTI 360
            :::....|...|.:|.|:|||..|...:.|:.|||||.|||||||.:|:  .:..:..:.:.|.:
  Fly   363 VNIVSGALNHAASKKLDLEAWFGGSGAYRELVSCSNCLDYQARRLLVRFGQTKKMNAAVDYVHML 427

  Fly   361 NGTATAIPRLLIALLESYQKEDGIEIPAVLRPFM 394
            |.|..|..|::.|:||::|.|.||::|..|:.:|
  Fly   428 NATMCAATRVICAILETHQTETGIKVPEPLKKYM 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 105/380 (28%)
class_II_aaRS-like_core 100..394 CDD:294192 93/330 (28%)
SerRSNP_001259982.1 PLN02678 3..476 CDD:215364 112/424 (26%)
Seryl_tRNA_N 3..111 CDD:280549 11/61 (18%)
SerRS_core 153..461 CDD:238393 90/310 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452774
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0172
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S479
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D495094at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100275
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.600

Return to query results.
Submit another query.