DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SerRS-m and Slimp

DIOPT Version :9

Sequence 1:NP_001262599.1 Gene:SerRS-m / 41862 FlyBaseID:FBgn0021750 Length:417 Species:Drosophila melanogaster
Sequence 2:NP_732958.1 Gene:Slimp / 318604 FlyBaseID:FBgn0051133 Length:464 Species:Drosophila melanogaster


Alignment Length:362 Identity:92/362 - (25%)
Similarity:146/362 - (40%) Gaps:59/362 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 TSAQLDELERNVVVRHHKNNVPLIRSLIQELDAGDQHKLRQLQAELE--------QLPNATHPRL 93
            ::.||:||:     .|.|       ||..||.|     |:|....:|        .|||..|.:.
  Fly   108 SAVQLEELK-----EHGK-------SLRNELKA-----LKQTLYPIEDDFIHDYLHLPNLLHVQC 155

  Fly    94 RDYGEEPRELAQYVHRQLTPQSRLKEFSELARALNLYRMDHLGNYTGHKSYYLTGQLATLEQAII 158
            ...|||     :.::|...|:|..|..|.|||       ..|.::..:..|||..|.|..:...:
  Fly   156 PVGGEE-----KLLYRHGIPKSENKTTSHLAR-------QELVHFVDNNRYYLMEQAALFDVNAM 208

  Fly   159 QYALQAVTEHG-FKLISVPDILPKEVIESCGM------RTEGERTQVYKLDTGECLSGTSEMALA 216
            |...:....|| |...:.||.:...::|:...      ..:.|..| .|::|.....|.|..:..
  Fly   209 QSLARYFVNHGHFIQTANPDFVRCVLLEANATPLSDYHLVQEEHLQ-NKINTAYLTGGASFESYL 272

  Fly   217 GFFANKLLSEDQLPLKVTAVSRCY-RAETSGLQEEKGIYRVHQFNKVEMF-AICTEEQSEAELEE 279
            |......:....|||:.....|.| |||.........:|...|.|.|::| |..|:.:::::||.
  Fly   273 GAMTKLCVYPSVLPLRYVCCGRSYNRAEADLYGPIPSLYTATQTNAVQIFVATQTDNEADSQLEH 337

  Fly   280 FKNIEVDLFRRLGLNFRL-----LDMPPCELGAPAYQKYDIEAWMPGRQMWGEISSCSNCTDYQA 339
            ..|:..|.::.|.:.||:     .|:.|.|     ..:..||.:.|..|.:..:...||..|:.:
  Fly   338 ILNLATDFYKALDIPFRISYATAADLTPAE-----SIRAVIEVYAPSLQRYVCVGRISNYGDFVS 397

  Fly   340 RRLGIRYRRSADGQILHAHTINGTATAIPRLLIALLE 376
            :|:....||......|  |.:.|......||:.||:|
  Fly   398 KRILFSTRREKHYDFL--HMVGGPVLYTSRLIAALVE 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SerRS-mNP_001262599.1 SerS 60..404 CDD:223250 86/339 (25%)
class_II_aaRS-like_core 100..394 CDD:294192 71/291 (24%)
SlimpNP_732958.1 serS 43..433 CDD:273066 92/362 (25%)
Seryl_tRNA_N 51..150 CDD:299883 16/58 (28%)
class_II_aaRS-like_core 194..433 CDD:294192 62/247 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452773
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0172
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11778
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.