DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sra-1 and fam49ba

DIOPT Version :9

Sequence 1:NP_650447.1 Gene:Sra-1 / 41861 FlyBaseID:FBgn0038320 Length:1291 Species:Drosophila melanogaster
Sequence 2:NP_956364.2 Gene:fam49ba / 337591 ZFINID:ZDB-GENE-030131-9537 Length:325 Species:Danio rerio


Alignment Length:289 Identity:67/289 - (23%)
Similarity:114/289 - (39%) Gaps:52/289 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 NFDTNFEDRNGFVTGIAKYIE-EATTHANLNVLLDEGQKHAVMLYTWRCCSRAIPQPKSNEQPNR 104
            ||..:||:        ||..| |......:|.:|.|.......|.::.....||.|  :.:.|:.
Zfish    18 NFFLDFEN--------AKPTEAERRVWEEVNGVLREAAIILQDLQSYSGAGEAIRQ--AIQHPSD 72

  Fly   105 VEIYEKTVEVLAPEVNKLLNFMYFQRKAIEAFSGEVKRL----C----HAEKRKDFVSEAYLLTL 161
            ..:.|:....:.|.|.||..|..|..|..:.....::.|    |    |.|:     .:|.....
Zfish    73 ERVQEQAWAAVVPLVGKLKKFYEFSLKLEDTLQNLLEYLTSSRCSPTQHLEQ-----EQALARQF 132

  Fly   162 GKFINMFAVLDELKNMKSSVKNDYSTYRRAAQFLKVMSDSHTLQE--------SQNLSMFLATQN 218
            .:.::.....||||....:::||:|.|||....::::  :.|.:|        :..:|:|.|...
Zfish   133 AEILHFTLRFDELKMTNPAIQNDFSYYRRTLSRMRII--NQTAEEHNEVDNELANRMSLFYANAT 195

  Fly   219 KIRDTVKDTLEKIVGYE---------DLLSDVVNICVHMFETKMYLT--PEEKHML--VKVMGFG 270
            .:..|:.|...|.|...         |.||.:.::|..|.||..|.:  ..|..:|  ::||...
Zfish   196 PMLKTLSDATTKFVSKHAELPVENTTDCLSTMASVCKVMLETPEYRSRFASEDTVLFCLRVMVGV 260

  Fly   271 LFLMD-----SDACNINKLDQKKKIRLDR 294
            :.|.|     ......:|:|.|..|::.|
Zfish   261 IILYDYVHPAGAFVKSSKIDMKGCIKVLR 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sra-1NP_650447.1 DUF1394 89..>267 CDD:399855 46/206 (22%)
FragX_IP 386..1244 CDD:399175
fam49baNP_956364.2 DUF1394 18..320 CDD:284554 67/289 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.