DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sra-1 and Cyria

DIOPT Version :9

Sequence 1:NP_650447.1 Gene:Sra-1 / 41861 FlyBaseID:FBgn0038320 Length:1291 Species:Drosophila melanogaster
Sequence 2:NP_001100188.1 Gene:Cyria / 298890 RGDID:1305961 Length:323 Species:Rattus norvegicus


Alignment Length:225 Identity:52/225 - (23%)
Similarity:91/225 - (40%) Gaps:37/225 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 EQPNRVEIYEKTVEVLAPEVNKLLNFMYFQRKAIEAFSGEVKRL-C-------HAEKRKDFVSEA 156
            :.||.:::.||....:.|.|.:|..|..|..:..:|....::.| |       |.|:.:....| 
  Rat    67 QNPNDIQLQEKAWNAVCPLVVRLKRFYEFSIRLEKALQSLLESLTCPPYTPTQHLEREQALAKE- 130

  Fly   157 YLLTLGKFINMFAVLDELKNMKSSVKNDYSTYRRAAQFLKVMSDSHTLQESQN------LSMFLA 215
                ..:.::.....||||....:::||:|.|||.....::.:....::...|      :|:|.|
  Rat   131 ----FAEILHFTLRFDELKMRNPAIQNDFSYYRRTISRNRINNMHLDIENEVNNEMANRMSLFYA 191

  Fly   216 TQNKIRDTVKDTLEKIVGYE---------DLLSDVVNICVHMFETKMY---LTPEEKHML-VKVM 267
            ....:..|:.:.....|...         |.||.:.::|..|.||..|   .|.||..|. ::||
  Rat   192 EATPMLKTLSNATMHFVSENKTLPIENTTDCLSTMTSVCKVMLETPEYRSRFTSEETLMFCMRVM 256

  Fly   268 GFGLFLMD-----SDACNINKLDQKKKIRL 292
            ...:.|.|     ...|..:|:|.|..|::
  Rat   257 VGVIILYDHVHPVGAFCKTSKIDMKGCIKV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sra-1NP_650447.1 DUF1394 89..>267 CDD:399855 43/193 (22%)
FragX_IP 386..1244 CDD:399175
CyriaNP_001100188.1 DUF1394 17..319 CDD:399855 52/225 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.