DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sra-1 and tmem151b

DIOPT Version :9

Sequence 1:NP_650447.1 Gene:Sra-1 / 41861 FlyBaseID:FBgn0038320 Length:1291 Species:Drosophila melanogaster
Sequence 2:NP_001090768.1 Gene:tmem151b / 100037854 XenbaseID:XB-GENE-5750851 Length:514 Species:Xenopus tropicalis


Alignment Length:302 Identity:57/302 - (18%)
Similarity:102/302 - (33%) Gaps:107/302 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EKITLADALSNVEVLDELSLPDEQP----------------------CIEAQP-CSI--IYKANF 42
            |:...|.|.::|:|.:| ..|::|.                      |:.|.. |.:  :.|.:|
 Frog    21 EEAAAAAATTDVDVREE-QRPEKQSLSASMCRESHWKCLLLSILMFVCLGAVTWCQVTSVTKLSF 84

  Fly    43 DTNFEDR----------NGFVTGIAKYI----------------------EEATTHANLNVLLDE 75
            |::.:.|          :|:|     ||                      .|....|:::.:.|:
 Frog    85 DSSLKGRSMIYHGSPCSDGYV-----YIPLAFLAMLYVVYLVECWHCHAKSELQNKADISSVHDQ 144

  Fly    76 GQ--KHAVMLYTWRCCS-------RAIPQPKSNEQPNRVEIYEKTVEVLAPEVNKLLNFMYFQRK 131
            .|  :.|.....|:..|       |.:.:.:..:.....::|.:.|.....|.    .|.| ...
 Frog   145 IQRMRQATPCIWWKAISYHFVRRTRQVTRYRHGDAYTTTQVYHERVNTHVAEA----EFEY-SHC 204

  Fly   132 AIEAFSGEVKRLCHAEKRKDFVS-EAYLLTLGKFINMFAVLDELKNMKSSVKNDYSTYRRAAQFL 195
            .|:..|            ||.:. |.:..|..||...|:    ..|::|  :|.|.|.|  |:| 
 Frog   205 GIKDIS------------KDLLDLERHPATKLKFTKCFS----FANVES--ENSYLTQR--ARF- 248

  Fly   196 KVMSDSHTLQESQNLSMFLATQNKIRDTVKDTLEKIVGYEDL 237
                    ..|.:.|..::..:..::....|..|.:|.|.||
 Frog   249 --------FTEIEGLDDYMEAREGMQLKNVDFKELVVAYVDL 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sra-1NP_650447.1 DUF1394 89..>267 CDD:399855 32/157 (20%)
FragX_IP 386..1244 CDD:399175
tmem151bNP_001090768.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..40 6/19 (32%)
TMEM151 39..451 CDD:291522 51/283 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165167083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.