DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and AT5G05420

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_196161.1 Gene:AT5G05420 / 830425 AraportID:AT5G05420 Length:143 Species:Arabidopsis thaliana


Alignment Length:164 Identity:65/164 - (39%)
Similarity:88/164 - (53%) Gaps:27/164 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 LSPGASAKKSGKEQNGVAKKEEAKQQQKKKEKPEAKKEQPKAKEPAKQQPASKDPRTITGGVKIV 256
            :||..||||:.|.......:.:|.....:|:.|:                        ..|:.:.
plant     1 MSPSESAKKNEKISEEATVESKAFSISVEKQTPD------------------------LDGLIVE 41

  Fly   257 DQVVG--KGEEAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVG 319
            :..:|  .|::|:.||||||:|.|:||.|.|.|||.:....:||.|..|:||||.|||:.||.||
plant    42 ELCMGNPNGKKAEPGKRVSVHYTGKLQGNGKIFDSTVGKSRYKFRLDAGKVIKGLDVGLNGMLVG 106

  Fly   320 GKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            |||.:|.||.|.|||.|| ..|.|:|.|||:|||
plant   107 GKRKLTIPPEMGYGAEGA-GSIPPDSWLVFDVEL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 53/92 (58%)
AT5G05420NP_196161.1 FKBP_C 51..140 CDD:278674 52/90 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 110 1.000 Domainoid score I2109
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 1 1.000 - - otm3436
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.810

Return to query results.
Submit another query.