DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and AT5G05420

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_196161.1 Gene:AT5G05420 / 830425 AraportID:AT5G05420 Length:143 Species:Arabidopsis thaliana


Alignment Length:164 Identity:65/164 - (39%)
Similarity:88/164 - (53%) Gaps:27/164 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 LSPGASAKKSGKEQNGVAKKEEAKQQQKKKEKPEAKKEQPKAKEPAKQQPASKDPRTITGGVKIV 256
            :||..||||:.|.......:.:|.....:|:.|:                        ..|:.:.
plant     1 MSPSESAKKNEKISEEATVESKAFSISVEKQTPD------------------------LDGLIVE 41

  Fly   257 DQVVG--KGEEAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVG 319
            :..:|  .|::|:.||||||:|.|:||.|.|.|||.:....:||.|..|:||||.|||:.||.||
plant    42 ELCMGNPNGKKAEPGKRVSVHYTGKLQGNGKIFDSTVGKSRYKFRLDAGKVIKGLDVGLNGMLVG 106

  Fly   320 GKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            |||.:|.||.|.|||.|| ..|.|:|.|||:|||
plant   107 GKRKLTIPPEMGYGAEGA-GSIPPDSWLVFDVEL 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 54/103 (52%)
AT5G05420NP_196161.1 FKBP_C 51..140 CDD:459735 52/90 (58%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.