DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and PnsL4

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_568067.1 Gene:PnsL4 / 830126 AraportID:AT4G39710 Length:217 Species:Arabidopsis thaliana


Alignment Length:118 Identity:40/118 - (33%)
Similarity:63/118 - (53%) Gaps:13/118 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 GVKIVDQVVGKGEEAKQGKRVSVYYIGRLQSNNKTFDSLLK-GKPFKFALGGGEVIKGWDVGVAG 315
            |:...|..||.|:||.:|..|:::|..|. ::...|||..| .:|....:|.|:||:|.|.|:.|
plant    95 GLGFCDLDVGFGDEAPRGVLVNIHYTARF-ADGTLFDSSYKRARPLTMRIGVGKVIRGLDQGILG 158

  Fly   316 ------MKVGGKRVITCPPHMAYGARGA-----PPKIGPNSTLVFEVELKAVH 357
                  |:|||||.:..||.:|||...|     ...|..|:||::::....::
plant   159 GEGVPPMRVGGKRKLQIPPKLAYGPEPAGCFSGDCNIPGNATLLYDINFVEIY 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 39/114 (34%)
PnsL4NP_568067.1 FKBP_C 106..205 CDD:459735 36/99 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.