DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and AT3G55520

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_191111.1 Gene:AT3G55520 / 824717 AraportID:AT3G55520 Length:190 Species:Arabidopsis thaliana


Alignment Length:85 Identity:41/85 - (48%)
Similarity:52/85 - (61%) Gaps:1/85 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 VSVYYIGRLQSNNKTFDSLLKGK-PFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGAR 335
            |.|:|.|.|..:.|.||:..:.. .|.|.||.|.||:.||:.:..||||....|||.|..|||..
plant    35 VDVHYEGILAEDEKVFDTTREDNLVFSFELGTGSVIRSWDIALKTMKVGEVAKITCKPEYAYGRA 99

  Fly   336 GAPPKIGPNSTLVFEVELKA 355
            |:||.|.|::||:|||||.|
plant   100 GSPPDIPPDATLIFEVELVA 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 41/85 (48%)
AT3G55520NP_191111.1 FKBP_C 34..118 CDD:459735 39/82 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.