DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and TWD1

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_188801.2 Gene:TWD1 / 821718 AraportID:AT3G21640 Length:365 Species:Arabidopsis thaliana


Alignment Length:127 Identity:33/127 - (25%)
Similarity:61/127 - (48%) Gaps:8/127 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 EPAKQ--QPASKDPRTITGGVKIVDQVVGKGEEAKQGKRVSVYYIGRL---QSNNKTFDSLLKGK 294
            ||:::  .|...|........|:..|::.:|..:|..|..:.:...|.   .|.:|..|:..:.:
plant    29 EPSQEGNVPPKVDSEAEVLDEKVSKQIIKEGHGSKPSKYSTCFLHYRAWTKNSQHKFEDTWHEQQ 93

  Fly   295 PFKFALG-GGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARG--APPKIGPNSTLVFEVEL 353
            |.:..|| ..:.:.|..:|||.||.|.:.::.....:|||..|  :.|.:.|.:.|::|||:
plant    94 PIELVLGKEKKELAGLAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 27/98 (28%)
TWD1NP_188801.2 FKBP_C 62..156 CDD:395196 26/94 (28%)
PRK15331 196..310 CDD:357168
TPR repeat 230..259 CDD:276809
TPR repeat 264..292 CDD:276809
TPR repeat 298..323 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.