DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and AT3G10060

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_187617.1 Gene:AT3G10060 / 820167 AraportID:AT3G10060 Length:230 Species:Arabidopsis thaliana


Alignment Length:128 Identity:49/128 - (38%)
Similarity:76/128 - (59%) Gaps:16/128 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   242 ASKDPR----TITGGVKIVDQVVGKGEEAKQGKRVSVYYIGRLQSNNKTFDSLLK------GKPF 296
            |||.|.    |:..|:|..|..||.|.||.:|.||:|:|:.:.:  ..||.:..:      |.|:
plant    92 ASKLPESDFTTLPNGLKYYDIKVGNGAEAVKGSRVAVHYVAKWK--GITFMTSRQGLGVGGGTPY 154

  Fly   297 KFALG---GGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVELKAV 356
            .|.:|   .|.|:||.|:||.||:|||:|::..||.:|||.:|. .:|.||:|:..::||.::
plant   155 GFDVGQSERGNVLKGLDLGVEGMRVGGQRLVIVPPELAYGKKGV-QEIPPNATIELDIELLSI 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 38/100 (38%)
AT3G10060NP_187617.1 FkpA <79..217 CDD:223619 49/128 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
32.770

Return to query results.
Submit another query.