DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp10a

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_009292452.1 Gene:fkbp10a / 799903 ZFINID:ZDB-GENE-100921-75 Length:563 Species:Danio rerio


Alignment Length:90 Identity:40/90 - (44%)
Similarity:49/90 - (54%) Gaps:1/90 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 EAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALG-GGEVIKGWDVGVAGMKVGGKRVITCPP 328
            |.:.|..|...|.|..:...|...||.||.||...:| ..:||.|.|.||.||.|..:|.||.||
Zfish    38 EVQIGDYVRYDYNGTFKDGRKFDSSLNKGFPFIGQVGVESKVIPGLDKGVQGMCVNERRKITVPP 102

  Fly   329 HMAYGARGAPPKIGPNSTLVFEVEL 353
            |:|||..|:...|.|.:||||:|.|
Zfish   103 HLAYGVLGSGSVIPPETTLVFDVHL 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 40/90 (44%)
fkbp10aXP_009292452.1 FKBP_C 35..128 CDD:306713 40/90 (44%)
FKBP_C 148..240 CDD:306713
FKBP_C 260..352 CDD:306713
FKBP_C 372..463 CDD:306713
EFh_CREC 490..>562 CDD:330175
EF-hand motif 526..554 CDD:320021
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583584
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.