DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Ttc9c

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_081688.2 Gene:Ttc9c / 70387 MGIID:1917637 Length:171 Species:Mus musculus


Alignment Length:46 Identity:13/46 - (28%)
Similarity:23/46 - (50%) Gaps:10/46 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LNMKPERKYSQTII-------KSFHISGVA---LDKGQEAKLYLAA 42
            :|.:..|:|||.::       |:.:.:|||   |.....|:.:|.|
Mouse    88 VNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDRARHHLLA 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511 13/46 (28%)
FkpA 253..356 CDD:440311
Ttc9cNP_081688.2 NlpI <6..155 CDD:443815 13/46 (28%)
TPR repeat 8..58 CDD:276809
TPR 1 8..41
TPR 2 72..107 5/18 (28%)
TPR repeat 74..102 CDD:276809 5/13 (38%)
TPR repeat 107..137 CDD:276809 8/27 (30%)
TPR 3 108..141 8/26 (31%)
TPR repeat 142..165 CDD:276809
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.