DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Ttc9c

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_081688.2 Gene:Ttc9c / 70387 MGIID:1917637 Length:171 Species:Mus musculus


Alignment Length:46 Identity:13/46 - (28%)
Similarity:23/46 - (50%) Gaps:10/46 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LNMKPERKYSQTII-------KSFHISGVA---LDKGQEAKLYLAA 42
            :|.:..|:|||.::       |:.:.:|||   |.....|:.:|.|
Mouse    88 VNYERVREYSQKVLERQPDNAKALYRAGVAFFHLQDYDRARHHLLA 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674
Ttc9cNP_081688.2 3a0801s09 2..>127 CDD:273380 10/38 (26%)
TPR repeat 8..58 CDD:276809
TPR 1 8..41
TPR 2 72..107 5/18 (28%)
TPR repeat 74..102 CDD:276809 5/13 (38%)
PEP_TPR_lipo <82..>152 CDD:274350 13/46 (28%)
TPR repeat 107..137 CDD:276809 8/27 (30%)
TPR 3 108..141 8/26 (31%)
TPR repeat 142..165 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839512
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.