DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp11

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_077131.2 Gene:Fkbp11 / 66120 MGIID:1913370 Length:201 Species:Mus musculus


Alignment Length:133 Identity:39/133 - (29%)
Similarity:59/133 - (44%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 PKAKEPAKQ-------QPASKDPRTITGGVKIVDQVVGKGEEAKQGKRVSVYYIGRLQSNNKTFD 288
            |:.:.|.:.       ||    |.:.|             |.|..|..:.::|.|.| .:.:..|
Mouse    29 PETESPVRTLQVETLVQP----PESCT-------------ESAAIGDTLHIHYTGSL-VDGRIID 75

  Fly   289 SLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            :.|...|....||..:||.|.:..:..|.||.||....|.|:|||.||.||.|..::.:.::|||
Mouse    76 TSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAVIPSHLAYGKRGYPPSIPADAVVQYDVEL 140

  Fly   354 KAV 356
            .|:
Mouse   141 IAL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 31/91 (34%)
Fkbp11NP_077131.2 FKBP_C 50..141 CDD:278674 32/104 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.