DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and FKBP1C

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001382909.1 Gene:FKBP1C / 642489 HGNCID:21376 Length:108 Species:Homo sapiens


Alignment Length:87 Identity:40/87 - (45%)
Similarity:53/87 - (60%) Gaps:0/87 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   267 KQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMA 331
            |:.:...::|.|.|:...|...|..:.|||||.||..|||:||:.||..|.||.:..:|..|..|
Human    18 KRSQTCVMHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVVQMSVGQRAKLTISPDYA 82

  Fly   332 YGARGAPPKIGPNSTLVFEVEL 353
            |||.|.|..|.|::||||:|||
Human    83 YGATGHPGIIPPHATLVFDVEL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 40/87 (46%)
FKBP1CNP_001382909.1 FKBP_C 15..105 CDD:459735 40/87 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.