powered by:
Protein Alignment Fkbp39 and Fkbp1b
DIOPT Version :9
| Sequence 1: | NP_524364.2 |
Gene: | Fkbp39 / 41860 |
FlyBaseID: | FBgn0013269 |
Length: | 357 |
Species: | Drosophila melanogaster |
| Sequence 2: | XP_038968726.1 |
Gene: | Fkbp1b / 58950 |
RGDID: | 61835 |
Length: | 201 |
Species: | Rattus norvegicus |
| Alignment Length: | 62 |
Identity: | 17/62 - (27%) |
| Similarity: | 28/62 - (45%) |
Gaps: | 17/62 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 40 LAAEKQEYIVATVTKAIPQVALDL---NFSKGDRIMFYT-----------AGDASVSLLGYL 87
||:.|...: :.||:|::.|.: |.||..|...:: ..:|||.||.|:
Rat 143 LASRKSSKV---LKKALPRIVLGMQVENCSKRGRRSLHSLRAKGLNWSSFTYEASVLLLNYI 201
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Fkbp39 | NP_524364.2 |
FKBP_C |
262..354 |
CDD:278674 |
|
| Fkbp1b | XP_038968726.1 |
None |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0545 |
| Hieranoid |
0 | 0.000 |
Not matched by this tool. |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001019 |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
1 |
0.910 |
- |
- |
|
|
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
| SwiftOrtho |
1 |
1.000 |
- |
- |
|
|
| TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.810 |
|
Return to query results.
Submit another query.
