DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and FKBP14

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_060416.1 Gene:FKBP14 / 55033 HGNCID:18625 Length:211 Species:Homo sapiens


Alignment Length:92 Identity:39/92 - (42%)
Similarity:52/92 - (56%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 EAKQGKRVSVYYIGRLQSNNKTFDSLLK---GKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITC 326
            :.|.|..:.|:|.|.|:.:...|.|..|   |:|..|.||..|.:||||.|:.||.||.||.:..
Human    41 KTKGGDLMLVHYEGYLEKDGSLFHSTHKHNNGQPIWFTLGILEALKGWDQGLKGMCVGEKRKLII 105

  Fly   327 PPHMAYGARGAPPKIGPNSTLVFEVEL 353
            ||.:.||..| ..||.|.|||:|.::|
Human   106 PPALGYGKEG-KGKIPPESTLIFNIDL 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 39/92 (42%)
FKBP14NP_060416.1 FkpA <43..135 CDD:223619 39/90 (43%)
EF-hand_7 141..204 CDD:404394
Prevents secretion from ER. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 208..211
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.