DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and FKBP7

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_851939.1 Gene:FKBP7 / 51661 HGNCID:3723 Length:222 Species:Homo sapiens


Alignment Length:145 Identity:46/145 - (31%)
Similarity:70/145 - (48%) Gaps:28/145 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 QQQKKKEKPEAKKEQPKAKEPAKQQPASKDPRTITGGVKIVDQVVGKGEEAKQGKRVSVYYIGRL 280
            |:|||:|..|..|                        ::::.:.....:.:|:|..::.:|.|.|
Human    24 QRQKKEESTEEVK------------------------IEVLHRPENCSKTSKKGDLLNAHYDGYL 64

  Fly   281 QSNNKTF---DSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARG-APPKI 341
            ..:...|   .:..:|.|..|.||.|:||||.|:.:..|..|.||.:..||..|||..| |..||
Human    65 AKDGSKFYCSRTQNEGHPKWFVLGVGQVIKGLDIAMTDMCPGEKRKVVIPPSFAYGKEGYAEGKI 129

  Fly   342 GPNSTLVFEVELKAV 356
            .|::||:||:||.||
Human   130 PPDATLIFEIELYAV 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 37/106 (35%)
FKBP7NP_851939.1 FKBP_C 46..141 CDD:459735 35/94 (37%)
FRQ1 <127..213 CDD:444056 11/18 (61%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 200..222
Retention in the endoplasmic reticulum. /evidence=ECO:0000255|PROSITE-ProRule:PRU10138 219..222
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.