DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and FKBP11

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_057678.1 Gene:FKBP11 / 51303 HGNCID:18624 Length:201 Species:Homo sapiens


Alignment Length:93 Identity:32/93 - (34%)
Similarity:49/93 - (52%) Gaps:1/93 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 EEAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPP 328
            |.|..|..:.::|.|.| .:.:..|:.|...|....||..:||.|.:..:..|.||.||....|.
Human    52 EPAAFGDTLHIHYTGSL-VDGRIIDTSLTRDPLVIELGQKQVIPGLEQSLLDMCVGEKRRAIIPS 115

  Fly   329 HMAYGARGAPPKIGPNSTLVFEVELKAV 356
            |:|||.||.||.:..::.:.::|||.|:
Human   116 HLAYGKRGFPPSVPADAVVQYDVELIAL 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 30/89 (34%)
FKBP11NP_057678.1 FKBP_C 50..141 CDD:365980 30/89 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.