DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and shu

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_611837.1 Gene:shu / 45360 FlyBaseID:FBgn0003401 Length:455 Species:Drosophila melanogaster


Alignment Length:274 Identity:64/274 - (23%)
Similarity:92/274 - (33%) Gaps:102/274 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 DEDDDQMTIENLLN----SKAIKNSKKSEDDEDENESGEEDEEDTDDDSQIIEEYESFLENGEEE 155
            :|:.:..|.:.|.|    |..:|...:.|.|..:.....:...|:|.||    :||..|      
  Fly     2 EENFEPYTPQLLKNPLSYSDLVKKGVEFEVDNSQQNHARDLGLDSDSDS----DYEDAL------ 56

  Fly   156 DDDDVDEDNEESGEE---------DEQDSDDSEAEEEQPKAKVAKLSPGASAKKSGKEQNGVAKK 211
               |||      |||         ||..:..||.:|                        .:.|:
  Fly    57 ---DVD------GEELRSPWTYSFDELRALMSEIDE------------------------NIYKR 88

  Fly   212 EEAKQQQKKKEKPEAKKEQPKAKEPAKQQPASKDPRTITGGVKIVDQVVGKGEEAKQGK-RVSVY 275
                                               .|.||.|         ..||...| ||||.
  Fly    89 -----------------------------------ITRTGHV---------DREAVPNKARVSVR 109

  Fly   276 YIGRLQSNNKTFD-SLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPP 339
            |.|..:.....|| |||:|..|.|..|.|.|::|.:|.|..|:...:........:.:|..|.||
  Fly   110 YSGYWEGETAPFDSSLLRGSKFVFETGQGTVVEGLEVAVRSMRPYEQAEFIISYKLLFGELGCPP 174

  Fly   340 KIGPNSTLVFEVEL 353
            :|.|.:..:|:||:
  Fly   175 RIKPKADALFKVEV 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 33/94 (35%)
shuNP_611837.1 FKBP_C 96..189 CDD:278674 33/93 (35%)
TPR repeat 218..257 CDD:276809
TPR repeat 262..295 CDD:276809
TPR repeat 304..329 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452515
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.