DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp1ab

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001005594.1 Gene:fkbp1ab / 449552 ZFINID:ZDB-GENE-040927-9 Length:108 Species:Danio rerio


Alignment Length:103 Identity:46/103 - (44%)
Similarity:61/103 - (59%) Gaps:1/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 GVKIVDQVVGKGEE-AKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAG 315
            ||:|.....|.|.. .|:|:...|:|:|.|....|...|..:.|||||.:|..|||:||:.||..
Zfish     2 GVEIETITPGDGRTFPKKGQTCVVHYVGSLTDGRKFDSSRDRDKPFKFKIGKQEVIRGWEEGVVQ 66

  Fly   316 MKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            |.||.:..:||.|..|||.:|.|..|.||:||:|:|||
Zfish    67 MSVGQRAKLTCSPDFAYGNKGHPGIIPPNATLIFDVEL 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 42/93 (45%)
fkbp1abNP_001005594.1 FKBP_C 13..105 CDD:278674 42/92 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001019
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.