DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp14

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001005108.1 Gene:fkbp14 / 448687 XenbaseID:XB-GENE-949902 Length:206 Species:Xenopus tropicalis


Alignment Length:95 Identity:40/95 - (42%)
Similarity:53/95 - (55%) Gaps:4/95 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   265 EAKQGKRVSVYYIGRLQSNNKTFDSLLK---GKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITC 326
            ::|.|..:.|:..|.|:.|...|.|..|   |:|..|.||..|||||||.|:..|.||.|..:..
 Frog    36 KSKNGDLLLVHAEGFLEKNGSRFHSTYKENNGQPVWFTLGIREVIKGWDKGLQDMCVGEKSKLIV 100

  Fly   327 PPHMAYGARGAPPKIGPNSTLVFEVELKAV 356
            ||.:|||..| ..||.|.|||:|.::|..:
 Frog   101 PPALAYGKEG-KGKIPPESTLIFNIDLMEI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 39/91 (43%)
fkbp14NP_001005108.1 FKBP_C 33..126 CDD:306713 39/90 (43%)
EF-hand_7 136..199 CDD:316058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.