DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp9

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001003520.1 Gene:fkbp9 / 445126 ZFINID:ZDB-GENE-040801-23 Length:564 Species:Danio rerio


Alignment Length:88 Identity:33/88 - (37%)
Similarity:50/88 - (56%) Gaps:0/88 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 AKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHM 330
            ||:|..|..:|...|........:.:.||.:...||.|:|:.|.:.|:.||.:|.||.:..|||:
Zfish   379 AKRGDFVKYHYNATLMDGTDIGSTHMYGKTYNVVLGSGQVVIGMEQGLTGMCIGEKRKLVIPPHL 443

  Fly   331 AYGARGAPPKIGPNSTLVFEVEL 353
            |||.||...::..::.||||||:
Zfish   444 AYGERGVDGEVPGSAVLVFEVEM 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 33/88 (38%)
fkbp9NP_001003520.1 FKBP_C 40..132 CDD:278674
FKBP_C 152..244 CDD:278674
FKBP_C 264..356 CDD:278674
FKBP_C 375..467 CDD:278674 33/88 (38%)
EF-hand_7 488..552 CDD:290234
EFh 490..551 CDD:298682
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.