DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp6

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001122145.1 Gene:fkbp6 / 402839 ZFINID:ZDB-GENE-050302-4 Length:343 Species:Danio rerio


Alignment Length:116 Identity:32/116 - (27%)
Similarity:55/116 - (47%) Gaps:6/116 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   241 PASKDPRTITGGVKIVDQVV--GKGEEAKQGKRVSVYYIGRLQSNNKTFDSLLKGK-PFKFALGG 302
            |..:|   |.|...::.:|:  |:|........||:.:.|.::..:..|::....| |....||.
Zfish    33 PQMQD---ILGDGGVLKEVIHEGEGPPVSMHASVSINFSGFIEYTDAPFETTNHLKYPRMMKLGK 94

  Fly   303 GEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            ...:.|.::|:..||.|........|..|||..|.||.|.|.:|:::||::
Zfish    95 DVTLYGLELGLLTMKKGEFSRFLFKPKYAYGDLGCPPHIPPCATVLYEVQV 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 26/93 (28%)
fkbp6NP_001122145.1 FKBP_C 63..146 CDD:278674 25/83 (30%)
TPR_12 174..258 CDD:290160
TPR repeat 214..255 CDD:276809
TPR_11 228..291 CDD:290150
TPR repeat 260..286 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.