Sequence 1: | NP_524364.2 | Gene: | Fkbp39 / 41860 | FlyBaseID: | FBgn0013269 | Length: | 357 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_957178.1 | Gene: | fkbp8 / 393858 | ZFINID: | ZDB-GENE-040426-1849 | Length: | 406 | Species: | Danio rerio |
Alignment Length: | 204 | Identity: | 55/204 - (26%) |
---|---|---|---|
Similarity: | 93/204 - (45%) | Gaps: | 37/204 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 DSD--DSEAEEEQPKAKVAKLSPGASAKKSGKEQNGVAKKEEAKQQQ----------KKKEKPEA 226
Fly 227 KKEQPKAKEPAKQQPASKDPRT-------ITGG----VKIVDQVVGKGEEAKQGKRVSVYYIGRL 280
Fly 281 QSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHMAYGARG-APPKIGPN 344
Fly 345 STLVFEVEL 353 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Fkbp39 | NP_524364.2 | FKBP_C | 262..354 | CDD:278674 | 29/93 (31%) |
fkbp8 | NP_957178.1 | FKBP_C | 106..194 | CDD:278674 | 29/92 (32%) |
TPR_11 | 214..296 | CDD:290150 | |||
TPR repeat | 214..259 | CDD:276809 | |||
TPR repeat | 265..293 | CDD:276809 | |||
TPR_11 | 266..330 | CDD:290150 | |||
TPR repeat | 298..328 | CDD:276809 | |||
TPR_1 | 299..332 | CDD:278916 | |||
TPR repeat | 333..361 | CDD:276809 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170583585 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0545 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.740 |