DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and ttc9c

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_956559.1 Gene:ttc9c / 393235 ZFINID:ZDB-GENE-040426-1053 Length:217 Species:Danio rerio


Alignment Length:77 Identity:24/77 - (31%)
Similarity:33/77 - (42%) Gaps:14/77 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 KAKVAKLSPG-ASAKKS-------GKEQNGVAKK-----EEAKQQQKKKEKPEAKKEQPKAKEPA 237
            :|.||.|..| |.|.:.       ||..:...||     ||...|..:|||...|....|.|: |
Zfish   141 RAGVASLELGDAPAARQYLTQASRGKPNDADVKKQLQRVEERLSQDYQKEKALYKGMFSKQKQ-A 204

  Fly   238 KQQPASKDPRTI 249
            ::|.|.:..|.:
Zfish   205 EEQIAEEKTREL 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674
ttc9cNP_956559.1 3a0801s09 <36..>191 CDD:273380 15/49 (31%)
TPR repeat 99..131 CDD:276809
TPR repeat 136..162 CDD:276809 7/20 (35%)
TPR repeat 170..195 CDD:276809 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.