DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp12

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_523792.2 Gene:Fkbp12 / 37214 FlyBaseID:FBgn0013954 Length:108 Species:Drosophila melanogaster


Alignment Length:106 Identity:51/106 - (48%)
Similarity:65/106 - (61%) Gaps:1/106 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 GVKIVDQVVGKGEE-AKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAG 315
            ||::|....|.|.. .|.|::|:|:|.|.|....|...|..:.|||||.:|.||||:|||.|||.
  Fly     2 GVQVVPIAPGDGSTYPKNGQKVTVHYTGTLDDGTKFDSSRDRNKPFKFTIGKGEVIRGWDEGVAQ 66

  Fly   316 MKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVELKAV 356
            :.||.:..:.|.|..|||:||.|..|.|||||.|:|||..|
  Fly    67 LSVGQRAKLICSPDYAYGSRGHPGVIPPNSTLTFDVELLKV 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 49/103 (48%)
Fkbp12NP_523792.2 FkpA 3..107 CDD:440311 49/103 (48%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.