DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp5

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_005166078.1 Gene:fkbp5 / 368924 ZFINID:ZDB-GENE-030616-630 Length:477 Species:Danio rerio


Alignment Length:108 Identity:52/108 - (48%)
Similarity:67/108 - (62%) Gaps:0/108 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   246 PRTITGGVKIVDQVVGKGEEAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWD 310
            |...:|..|||.|...:||....|.||.|:|.|||.|..|...||.:.:||.|.:|.|:|||.||
Zfish    51 PNGDSGVCKIVKQHGVEGERPMIGDRVFVHYTGRLLSGKKFDSSLDRKEPFVFNVGKGQVIKAWD 115

  Fly   311 VGVAGMKVGGKRVITCPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            :.|..|:.|...::.|.|..|||:.|:|||:.||||||||:||
Zfish   116 ICVCSMQKGEVCLMLCKPEYAYGSAGSPPKVPPNSTLVFEIEL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 46/92 (50%)
fkbp5XP_005166078.1 FKBP_C 69..159 CDD:278674 45/90 (50%)
FkpA <167..271 CDD:223619
TPR_11 291..372 CDD:290150
TPR repeat 292..320 CDD:276809
TPR repeat 340..370 CDD:276809
TPR_11 343..405 CDD:290150
TPR 343..374 CDD:197478
TPR repeat 375..403 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583586
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.