DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp11

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001012249.1 Gene:fkbp11 / 368823 ZFINID:ZDB-GENE-030616-357 Length:192 Species:Danio rerio


Alignment Length:88 Identity:34/88 - (38%)
Similarity:48/88 - (54%) Gaps:1/88 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   266 AKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHM 330
            ::.|..:.::|.|||. :.|..|:.|..:|....||...||.|.:..:.|:..|.|.....|.|:
Zfish    48 SEMGDTLQIHYTGRLM-DGKVIDTSLSREPLVVELGKRSVITGLEQALVGVCEGQKIKAMIPAHL 111

  Fly   331 AYGARGAPPKIGPNSTLVFEVEL 353
            |||.||.||.|..:|||.||||:
Zfish   112 AYGKRGYPPTIPGDSTLEFEVEV 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 34/88 (39%)
fkbp11NP_001012249.1 FKBP_C 44..135 CDD:278674 34/88 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.