DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and fkbp7

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001004506.1 Gene:fkbp7 / 368498 ZFINID:ZDB-GENE-030616-182 Length:219 Species:Danio rerio


Alignment Length:93 Identity:39/93 - (41%)
Similarity:56/93 - (60%) Gaps:4/93 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 EEAKQGKRVSVYYIGRLQSNNKTF---DSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVIT 325
            ::||:|..::.:|.|.|..:...|   .:..||.|..|.||.|.:|||.||.:..|..|.||.:|
Zfish    47 QKAKRGDMLNAHYDGFLAKDGSQFYCSRTTEKGHPHWFVLGVGNIIKGLDVALQDMCPGEKRKVT 111

  Fly   326 CPPHMAYGARGAPPKIGPNSTLVFEVEL 353
            .||.:|||.:|..| :.||:|::|||||
Zfish   112 IPPSLAYGEKGNGP-VPPNATVIFEVEL 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 39/93 (42%)
fkbp7NP_001004506.1 FKBP_C 45..139 CDD:459735 39/93 (42%)
EF-hand_7 149..211 CDD:463900
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.