DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp5

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_006256284.1 Gene:Fkbp5 / 361810 RGDID:1309155 Length:473 Species:Rattus norvegicus


Alignment Length:155 Identity:63/155 - (40%)
Similarity:83/155 - (53%) Gaps:15/155 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 VAKKEEA-----KQQQKKKEKPEAKKEQPKAK--EPAKQQPASKDPRTITGGVKIVDQVVGKGEE 265
            |...|||     ::.....|.....:|.|.|.  |..:.....||    .|.:|||.: ||..||
  Rat     3 VTSTEEAEVFYLQRTMTTDEGTSNNEENPAATVVEQGEDITTKKD----RGVLKIVKR-VGTSEE 62

  Fly   266 AKQ-GKRVSVYYIGRLQSNNKTFDSLL-KGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPP 328
            ... |.:|.|:|.|:| ||.|.|||.. :.:||.|:||.|:|||.||:||:.||.|....:.|.|
  Rat    63 TPMIGDKVYVHYKGKL-SNGKKFDSSRDRNEPFVFSLGKGQVIKAWDIGVSTMKKGEICHLLCKP 126

  Fly   329 HMAYGARGAPPKIGPNSTLVFEVEL 353
            ..|||:.|:.|||..|:||.||:||
  Rat   127 EYAYGSAGSLPKIPSNATLFFEIEL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 46/94 (49%)
Fkbp5XP_006256284.1 FKBP_C 61..152 CDD:278674 46/92 (50%)
TPR_11 284..364 CDD:290150
TPR repeat 285..313 CDD:276809
TPR_11 336..399 CDD:290150
TPR 336..367 CDD:197478
TPR repeat 336..362 CDD:276809
TPR repeat 367..397 CDD:276809
TPR_1 369..401 CDD:278916
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343334
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.