DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp10

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:XP_038942330.1 Gene:Fkbp10 / 360627 RGDID:1549751 Length:620 Species:Rattus norvegicus


Alignment Length:93 Identity:36/93 - (38%)
Similarity:50/93 - (53%) Gaps:7/93 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   264 EEAKQGKRVSVYYIGRLQSNNKTFDSLLKGKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPP 328
            |.||.|..:..:|...|....:.|.|.....|.:..||..:||:|.|.|:.||.||.:|.:..||
  Rat   432 ETAKIGDFIRYHYNCSLLDGTRLFSSHDYEAPQEITLGANKVIEGLDRGLQGMCVGERRQLIVPP 496

  Fly   329 HMAY---GARGAPPKIGPNSTLVFEVEL 353
            |:|:   ||||.|    .::.|:|||||
  Rat   497 HLAHGENGARGVP----GSAVLLFEVEL 520

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 36/93 (39%)
Fkbp10XP_038942330.1 FKBP_C 54..146 CDD:459735
FKBP_C 166..297 CDD:459735
FKBP_C 317..409 CDD:459735
FKBP_C 430..521 CDD:459735 36/93 (39%)
FRQ1 521..>606 CDD:444056 36/93 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.