DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp3

DIOPT Version :10

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_038930.1 Gene:Fkbp3 / 30795 MGIID:1353460 Length:224 Species:Mus musculus


Alignment Length:154 Identity:47/154 - (30%)
Similarity:70/154 - (45%) Gaps:28/154 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 EEAKQQQKKKEKPEAKKEQPKAKEPAKQQPASKDPRTITGGVKIVDQVVGKGEEA---KQGKRVS 273
            |:.|..:...:||:..|.:....|               |..|....::.||::.   |:|..|.
Mouse    83 EQVKNVKLSDDKPKDSKSEETLDE---------------GPPKYTKSILKKGDKTNFPKKGDVVH 132

  Fly   274 VYYIGRLQSNNKTFDSLLK--------GKPFKFALGGGEVIKGWDVGVAGMKVGGKRVITCPPHM 330
            .:|.|.| .:...||:.::        .||..|.:|.|:||:|||..:..|..|.|..:...|..
Mouse   133 CWYTGTL-PDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEKARLEIEPEW 196

  Fly   331 AYGARGAP-PKIGPNSTLVFEVEL 353
            |||.:|.| .||.||:.|:|||||
Mouse   197 AYGKKGQPDAKIPPNTKLIFEVEL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 NPL 4..86 CDD:465511
FkpA 253..356 CDD:440311 40/113 (35%)
Fkbp3NP_038930.1 BTHB_FKBP25 7..73 CDD:439139
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..118 6/44 (14%)
FKBP_C 124..221 CDD:459735 37/98 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.