DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fkbp39 and Fkbp3

DIOPT Version :9

Sequence 1:NP_524364.2 Gene:Fkbp39 / 41860 FlyBaseID:FBgn0013269 Length:357 Species:Drosophila melanogaster
Sequence 2:NP_001100206.2 Gene:Fkbp3 / 299104 RGDID:1304992 Length:224 Species:Rattus norvegicus


Alignment Length:163 Identity:49/163 - (30%)
Similarity:75/163 - (46%) Gaps:24/163 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 KEQNGVAKKEEAKQQQKKKEKPEAKKEQPKAKEPAKQQPASKDPRTITGGVKIVDQVVGKGEEA- 266
            |...|.....:..:|.|..:..:.|::..|::|...:.|.           |....|:.||::. 
  Rat    70 KRFKGTETISKVSEQVKNVKLNDDKQKDSKSEETLDEGPP-----------KYTKSVLKKGDKTN 123

  Fly   267 --KQGKRVSVYYIGRLQSNNKTFDSLLK--------GKPFKFALGGGEVIKGWDVGVAGMKVGGK 321
              |:|..|..:|.|.| .:...||:.::        .||..|.:|.|:||:|||..:..|..|.|
  Rat   124 FPKKGDVVHCWYTGTL-PDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALLTMSKGEK 187

  Fly   322 RVITCPPHMAYGARGAP-PKIGPNSTLVFEVEL 353
            ..:...|..|||.:|.| .||.||:.|:|||||
  Rat   188 ARLEIEPEWAYGKKGQPDAKIPPNTKLIFEVEL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fkbp39NP_524364.2 FKBP_C 262..354 CDD:278674 39/104 (38%)
Fkbp3NP_001100206.2 BTHB 6..76 CDD:408209 2/5 (40%)
FKBP_C 124..221 CDD:395196 37/98 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0545
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.